PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG042286t1
Common NameTCM_042286
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 396aa    MW: 43000.6 Da    PI: 6.7509
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG042286t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.91.2e-09197245553
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                       kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l   +
  Thecc1EG042286t1 197 KRAKRILANRQSAARSKERKARYILELERKVQTLQTEATTLSAQLTLFQ 245
                       9****************************************99887655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.7E-15193257IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.542195258IPR004827Basic-leucine zipper domain
PfamPF001701.7E-8197245IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.95E-10197248No hitNo description
Gene3DG3DSA:1.20.5.1701.0E-9197251No hitNo description
CDDcd147033.96E-23198247No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MEIQDPQAKP GPNFNSSSIT RMSGPQPNAT AMFGSSSSSN HNNKSSNNNN PSNSSSSSAF  60
MRGGGGHHRR AHSEMSFRLP DDMSIMMMDL SPPSDPINAG GGSSTASFEE MGSEDDLFST  120
YIDVDKLNSS EATNGRTNCT DHSEGEKLTS SSTTATSSRP RHRHSNSVDG SAYGEVMEAK  180
KAMPPDKLAE LWNLDPKRAK RILANRQSAA RSKERKARYI LELERKVQTL QTEATTLSAQ  240
LTLFQRDTTG LSTENTELKL RLQAMEQQAQ LRDALNEALK KEVERLKIAT GEIMSPSESF  300
SLGMHQMPYT ASTFLSLPPQ QGAAGPQNMQ LPSFTGSQST MSTYHPPQMN QHHLSDIMQN  360
DPLGRLQGLD ISSKGSNLVK TEGPSISASE SSFTF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007017082.10.0Basic-leucine zipper transcription factor family protein
SwissprotQ6S4P41e-106RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A061GYW10.0A0A061GYW1_THECC; Basic-leucine zipper transcription factor family protein
STRINGPOPTR_0019s15040.11e-166(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.15e-98bZIP family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]